Beta Amyloid [1-42] Peptide (Rat)

Protein Family: Proteoglycans

Pathway and Disease: Neurodegenerative Disorders

Alternate Names: Beta-amyloid protein 40; Beta-APP40; P3(40); Amyloid beta A4 protein; APP; ABPP; Alzheimer disease amyloid protein; Cerebral vascular amyloid peptide; CVAP; Protease nexin-II; PN-II; APPI; PreA4

Accession No.: P08592

Description:
Beta-amyloid production results from cleavage in the extracellular domain of APP by the beta-secretase (BACE1), which results in the production of the APP C-terminal fragment C99. This fragment is further cleaved by the gamma-secretase at residues 40-42 to produce beta-amyloid 40 and 42 peptides. Beta-amyloid aggregation and neuritic plaque formation are pathologic hallmarks of Alzheimer disease. This peptide corresponds to the rat beta-amyloid 1-42 peptide.

Format:
Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt.

MW: 4418.05 g/mol

Sequence:
Rat: H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH or H-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH

Composition:
C199H307N53O59S1

Purity:
> 95% by HPLC

Solubility:
We recommend using 100% dimethyl sulfoxide (DMSO). Alternatively, hexafluoroisopropanol (HFIP) can be used.

Storage:
Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C.