Beta Glucuronidase(Gusb) polyclonal, anti-human antibody

Beta Glucuronidase(Gusb) polyclonal, anti-human antibody

€270.00
In stock
SKU
AC-ABO11219
Catalog Number: AC-ABO11219
Size: 100 µg
Host: rabbit IgG
Applications: WB
Datasheet

Request Information
Description: Rabbit IgG polyclonal antibody for Homeobox protein OTX2 (OTX2) detection. Tested with WB in human.

Protein Name: Homeobox protein OTX2

Background:
Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.

Other Names:
Homeobox protein OTX2, Orthodenticle homolog 2, OTX2

Subcellular Localization: Nucleus .

Tissue Specificity: Expressed in brain.

Gene ID: 5015

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence.

Calculated MW: 31636

Purification: Immunogen affinity purified.

Format: Lyophilized

Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.

Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Beta Glucuronidase(Gusb) polyclonal, anti-human antibody