Beta Glucuronidase(Gusb) polyclonal, anti-human antibody
€270.00
In stock
SKU
AC-ABO11219
Description: Rabbit IgG polyclonal antibody for Homeobox protein OTX2 (OTX2) detection. Tested with WB in human.
Protein Name: Homeobox protein OTX2
Background:
Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.
Other Names:
Homeobox protein OTX2, Orthodenticle homolog 2, OTX2
Subcellular Localization: Nucleus .
Tissue Specificity: Expressed in brain.
Gene ID: 5015
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence.
Calculated MW: 31636
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Name: Homeobox protein OTX2
Background:
Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.
Other Names:
Homeobox protein OTX2, Orthodenticle homolog 2, OTX2
Subcellular Localization: Nucleus .
Tissue Specificity: Expressed in brain.
Gene ID: 5015
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence.
Calculated MW: 31636
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review