Beta III Tubulin Picoband polyclonal, anti-human, mouse, rat

Beta III Tubulin Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10218
Catalog Number: AC-ABO10218
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Tubulin beta-3 chain

Protein Function:
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain. TUBB3 plays a critical role in proper axon guidance and mantainance. .

Other Names: Tubulin beta-3 chain, Tubulin beta-4 chain, Tubulin beta-III, TUBB3, TUBB4

Subcellular Localization: Cytoplasm, cytoskeleton.

Tissue Specificity: Expression is primarily restricted to central and peripheral nervous system. Greatly increased expression in most cancerous tissues. .

Gene ID: 10381

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Beta III Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.

Calculated MW: 50433

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Beta III Tubulin Picoband polyclonal, anti-human, mouse, rat