Bmi1 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO11834
Catalog Number: AC-ABO11834
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Polycomb complex protein BMI-1(BMI1) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Polycomb complex protein BMI-1
Protein Function:
Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2. .
Other Names: Polycomb complex protein BMI-1, Polycomb group RING finger protein 4, RING finger protein 51, BMI1, PCGF4, RNF51
Subcellular Localization: Nucleus. Cytoplasm.
Gene ID: 100532731;648
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.
Calculated MW: 36949
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2. .
Other Names: Polycomb complex protein BMI-1, Polycomb group RING finger protein 4, RING finger protein 51, BMI1, PCGF4, RNF51
Subcellular Localization: Nucleus. Cytoplasm.
Gene ID: 100532731;648
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.
Calculated MW: 36949
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review