Bmi1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
BMI1(BMI1 polycomb ring finger oncogene), also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The Bmi1 gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain. By fluorescence in situ hybridization, the human BMI1 gene is assigned to chromosome 10p13. BMI1 has a key role in regulating the proliferative activity of normal stem and progenitor cells. Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia. Complementation studies showed that BMI1 completely rescues these proliferative defects. Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4). BMI1 selectively extended the life span of these cultures. Confocal microscopy showed that BMI1 transiently colocalized with centromeres during interphase in HeLa cells.

Description:
Rabbit IgG polyclonal antibody for Polycomb complex protein BMI-1 (BMI1) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
B lymphoma Mo MLV insertion region (mouse) antibody, B lymphoma Mo MLV insertion region 1 homolog antibody, Bmi 1 antibody, BMI1 antibody, BMI1 polycomb ring finger oncogene antibody, BMI1_HUMAN antibody, Flvi 2/bmi 1 antibody, FLVI2/BMI1 antibody, MGC12685 antibody, Murine leukemia viral (bmi 1) oncogene homolog antibody, Oncogene BMI 1 antibody, PCGF 4 antibody, PCGF4 antibody, Polycomb complex protein BMI 1 antibody, Polycomb complex protein BMI-1 antibody, Polycomb group protein Bmi1 antibody, Polycomb group ring finger 4 antibody, Polycomb group RING finger protein 4 antibody, RING finger protein 51 antibody, RNF 51 antibody, RNF51 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.