BMP-2 polyclonal, anti-human, rat

BMP-2 polyclonal, anti-human, rat

€455.00
In stock
SKU
AC-ABO12373
Catalog Number: AC-ABO12373
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P, E
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Bone morphogenetic protein 2(BMP2) detection. Tested with WB, IHC-P, ELISA in Human;Rat.Protein Name: Bone morphogenetic protein 2

Protein Function:
Induces cartilage and bone formation (PubMed:3201241). Stimulates the differentiation of myoblasts into osteoblasts via the EIF2AK3-EIF2A- ATF4 pathway. BMP2 activation of EIF2AK3 stimulates phosphorylation of EIF2A which leads to increased expression of ATF4 which plays a central role in osteoblast differentiation. In addition stimulates TMEM119, which upregulates the expression of ATF4 (PubMed:24362451). .

Other Names: Bone morphogenetic protein 2, BMP-2, Bone morphogenetic protein 2A, BMP-2A, BMP2, BMP2A

Subcellular Localization: Secreted.

Tissue Specificity: Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine.

Gene ID: 650

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND), identical to the related mouse and rat sequences.

Calculated MW: 44702

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:BMP-2 polyclonal, anti-human, rat