BMP-4 polyclonal, anti-human, mouse

BMP-4 polyclonal, anti-human, mouse

€455.00
In stock
SKU
AC-ABO12374
Catalog Number: AC-ABO12374
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, E
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Bone morphogenetic protein 4(BMP4) detection. Tested with WB, ELISA in Human;Mouse.Protein Name: Bone morphogenetic protein 4

Protein Function:
Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction (By similarity). .

Other Names: Bone morphogenetic protein 4, BMP-4, Bone morphogenetic protein 2B, BMP-2B, BMP4, BMP2B, DVR4

Subcellular Localization: Secreted, extracellular space, extracellular matrix.

Tissue Specificity: Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.

Gene ID: 652

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND), different from the related mouse and rat sequences by two amino acids.

Calculated MW: 46555

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:BMP-4 polyclonal, anti-human, mouse