BMP-5 polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12375
Catalog Number: AC-ABO12375
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P, E
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P, E
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Bone morphogenetic protein 5(BMP5) detection. Tested with WB, IHC-P, ELISA in Human;Mouse;Rat.Protein Name: Bone morphogenetic protein 5
Protein Function:
Induces cartilage and bone formation.
Other Names: Bone morphogenetic protein 5, BMP-5, BMP5
Subcellular Localization: Secreted.
Tissue Specificity: Expressed in the lung and liver.
Gene ID: 653
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Calculated MW: 51737
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Induces cartilage and bone formation.
Other Names: Bone morphogenetic protein 5, BMP-5, BMP5
Subcellular Localization: Secreted.
Tissue Specificity: Expressed in the lung and liver.
Gene ID: 653
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Calculated MW: 51737
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review