BMP4 polyclonal, anti-human, mouse

BMP4 polyclonal, anti-human, mouse

€384.00
In stock
SKU
ARP-10-P9688
Catalog Number: 10-P9688
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
Bone morphogenetic protein 4 is a protein that in humans is encoded by BMP4 gene. It is found on chromosome 14q22-q23. The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.

Description:
Rabbit IgG polyclonal antibody for Bone morphogenetic protein 4 (BMP4) detection. Tested with WB, ELISA in Human, Mouse.

Synonyms:
BMP 2B antibody, BMP 4 antibody, BMP-2B antibody, BMP-4 antibody, BMP2B antibody, BMP2B1 antibody, BMP4 antibody, BMP4_HUMAN antibody, Bone morphogenetic protein 2B antibody, Bone morphogenetic protein 4 antibody, DVR4 antibody, MCOPS6 antibody, OFC11 antibody, ZYME antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND), different from the related mouse and rat sequences by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse

Applications: WB, ELISA

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:BMP4 polyclonal, anti-human, mouse