BRMS1 Picoband polyclonal, anti-human, mouse, rat antibody

BRMS1 Picoband polyclonal, anti-human, mouse, rat antibody

€270.00
In stock
SKU
AC-ABO13019
Catalog Number: AC-ABO13019
Size: 100 µg
Host: rabbit IgGWB
Datasheet

Request Information
Description: Rabbit IgG polyclonal antibody for P2RY5 detection. Tested with WB in human, mouse, rat.

Background:
Binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is involved in the receptor activation. Important for the maintenance of hair growth and texture.

Subcellular Localization: Cell membrane.

Tissue Specificity: Expressed ubiquitously, including in skin and hair follicle cells. Detected in both Henle's and Huxley's layers of the inner root sheath of the hair follicle and in suprabasal layers of the epidermis (at protein level). Expressed at low levels in peripheral blood leukocytes.

Immunogen: A synthetic peptide corresponding to a sequence of human P2RY5 (DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK).

Format: Lyophilized

Contents: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.

Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:BRMS1 Picoband polyclonal, anti-human, mouse, rat antibody