c-Rel polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-κB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.

Description:
Rabbit IgG polyclonal antibody for Proto-oncogene c-Rel (REL) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
Avian reticuloendotheliosis antibody, C REL antibody, C Rel protein antibody, c Rel proto oncogene protein antibody, Oncogene REL antibody, Oncogene REL avian reticuloendotheliosis antibody, Proto-oncogene c-Rel antibody, REL antibody, REL_HUMAN antibody, v rel avian reticuloendotheliosis viral oncogene homolog antibody, v rel reticuloendotheliosis viral oncogene homolog antibody, V rel reticuloendotheliosis viral oncogene homolog (avian) antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.