Carboxypeptidase A Picoband polyclonal, anti-human, mouse, rat

Carboxypeptidase A Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO13048
Catalog Number: AC-ABO13048
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Carboxypeptidase A detection. Tested with WB in Human;Mouse;Rat.

Protein Function:
Carboxypeptidase that catalyzes the release of a C- terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro.

Other Names: Carboxypeptidase A1, 3.4.17.1, CPA1, CPA

Subcellular Localization: Secreted.

Gene ID: 1357

Immunogen: A synthetic peptide corresponding to a sequence of human Carboxypeptidase A (KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD).

Calculated MW: 47140

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Carboxypeptidase A Picoband polyclonal, anti-human, mouse, rat