Cardiac FABP polyclonal, anti-human, mouse, rat

Cardiac FABP polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9759
Catalog Number: 10-P9759
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
Heart-type fatty acid binding protein (hFABP), also known as mammary-derived growth inhibitor, is a protein that in humans is encoded by the FABP3 gene. The intracellular fatty acid-binding proteins (FABPs) belong to a multigene family. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is also a candidate tumor suppressor gene for human breast cancer. Cardiac-type fatty acid-binding protein (cFABP) from human heart muscle of three individuals was isolated and characterized as pI 5.3-cFABP.

Description:
Rabbit IgG polyclonal antibody for Fatty acid-binding protein, heart (FABP3) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
422 protein antibody, Cardiac Fatty Acid Binding Protein antibody, FABP 11 antibody, FABP 3 antibody, FABP11 antibody, FABP3 antibody, FABPH_HUMAN antibody, Fatty acid binding protein 11 antibody, Fatty acid binding protein 3 antibody, Fatty acid binding protein 3 muscle and heart antibody, Fatty acid binding protein 3 muscle and heart mammary derived growth inhibitor antibody, Fatty acid binding protein 3 muscle antibody, Fatty acid binding protein 3, muscle and heart (mammary derived growth inhibitor) antibody, Fatty acid binding protein 3, muscle antibody, Fatty acid binding protein heart antibody, Fatty acid binding protein, heart antibody, Fatty acid binding protein, muscle and heart antibody, Fatty acid binding protein, skeletal muscle antibody, Fatty acid-binding protein 3 antibody, Fatty acid-binding protein antibody, H FABP antibody, H-FABP antibody, heart antibody, Heart type fatty acid binding protein antibody, Heart-type fatty acid-binding protein antibody, M FABP antibody, M-FABP antibody, Mammary derived growth inhibitor antibody, Mammary-derived growth inhibitor antibody, MDGI antibody, Muscle fatty acid binding protein antibody, Muscle fatty acid-binding protein antibody, Mylein protein P2 homolog antibody, O FABP antibody, OTTHUMP00000003898 antibody, P2 adopocyte protein antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human Cardiac FABP (15-48aa KNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGD), identical to the related mouse and rat sequences.A synthetic peptide corresponding to a sequence at the N-terminus of human Cardiac FABP (15-48aa KNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGD), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse, rat.
Predicted to work with: human.

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Cardiac FABP polyclonal, anti-human, mouse, rat