Caspase-2 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
CASP2 is equal to Caspase-2. And Caspase-2, which is involved in stress-induced apoptosis, is recruited into a large protein complex, the molecular composition of which remains elusive. It is showed that activation of caspase-2 occurs in a complex that contains the death domain-containing protein PIDD, whose expression is induced by p53, and the adaptor protein RAIDD. Increased PIDD expression resulted in spontaneous activation of caspase-2 and sensitization to apoptosis by genotoxic stimuli. Caspase-2 acts both as a positive and negative cell death effector, depending upon cell lineage and stage of development.

Description:
Rabbit IgG polyclonal antibody for Caspase-2 (CASP2) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
CASP 2 antibody, CASP-2 antibody, Casp2 antibody, CASP2_HUMAN antibody, Caspase 2 antibody, Caspase 2 apoptosis related cysteine peptidase antibody, Caspase-2 subunit p12 antibody, Caspase2 antibody, ICH 1 antibody, ICH 1 protease antibody, ICH 1L antibody, ICH1 antibody, ICH1 protease antibody, ICH1L antibody, NEDD-2 antibody, NEDD2 antibody, Neural precursor cell expressed developmentally down-regulated protein 2 antibody, PPP1R57 antibody, Protease ICH-1 antibody, Protein phosphatase 1 regulatory subunit 57 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Caspase-2(378-409aa RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.