CCDC6 Picoband polyclonal, anti-human, rat

CCDC6 Picoband polyclonal, anti-human, rat

€455.00
In stock
SKU
AC-ABO11668
Catalog Number: AC-ABO11668
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection. Tested with WB in Human;Rat.Protein Name: Coiled-coil domain-containing protein 6

Other Names: Coiled-coil domain-containing protein 6, Papillary thyroid carcinoma-encoded protein, Protein H4, CCDC6, D10S170, TST1

Subcellular Localization: Cytoplasm. Cytoplasm, cytoskeleton . May be a cytoskeletal protein.

Tissue Specificity: Ubiquitously expressed.

Gene ID: 8030

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CCDC6 (156-198aa KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence.

Calculated MW: 53291

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CCDC6 Picoband polyclonal, anti-human, rat