CCDC6 Picoband polyclonal, anti-human, rat
€455.00
In stock
SKU
AC-ABO11668
Catalog Number: AC-ABO11668
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection. Tested with WB in Human;Rat.Protein Name: Coiled-coil domain-containing protein 6
Other Names: Coiled-coil domain-containing protein 6, Papillary thyroid carcinoma-encoded protein, Protein H4, CCDC6, D10S170, TST1
Subcellular Localization: Cytoplasm. Cytoplasm, cytoskeleton . May be a cytoskeletal protein.
Tissue Specificity: Ubiquitously expressed.
Gene ID: 8030
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CCDC6 (156-198aa KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence.
Calculated MW: 53291
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Other Names: Coiled-coil domain-containing protein 6, Papillary thyroid carcinoma-encoded protein, Protein H4, CCDC6, D10S170, TST1
Subcellular Localization: Cytoplasm. Cytoplasm, cytoskeleton . May be a cytoskeletal protein.
Tissue Specificity: Ubiquitously expressed.
Gene ID: 8030
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CCDC6 (156-198aa KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence.
Calculated MW: 53291
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review