CCT3 Picoband polyclonal, anti-human, rat
€455.00
In stock
SKU
AC-ABO12611
Catalog Number: AC-ABO12611
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit gamma(CCT3) detection. Tested with WB in Human;Rat.Protein Name: T-complex protein 1 subunit gamma
Protein Function:
Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin. .
Other Names: T-complex protein 1 subunit gamma, TCP-1-gamma, CCT-gamma, hTRiC5, CCT3, CCTG, TRIC5
Subcellular Localization: Cytoplasm.
Gene ID: 7203
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.
Calculated MW: 60534
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin. .
Other Names: T-complex protein 1 subunit gamma, TCP-1-gamma, CCT-gamma, hTRiC5, CCT3, CCTG, TRIC5
Subcellular Localization: Cytoplasm.
Gene ID: 7203
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.
Calculated MW: 60534
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review