CCT3 Picoband polyclonal, anti-human, rat

CCT3 Picoband polyclonal, anti-human, rat

€455.00
In stock
SKU
AC-ABO12611
Catalog Number: AC-ABO12611
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit gamma(CCT3) detection. Tested with WB in Human;Rat.Protein Name: T-complex protein 1 subunit gamma

Protein Function:
Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin. .

Other Names: T-complex protein 1 subunit gamma, TCP-1-gamma, CCT-gamma, hTRiC5, CCT3, CCTG, TRIC5

Subcellular Localization: Cytoplasm.

Gene ID: 7203

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.

Calculated MW: 60534

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CCT3 Picoband polyclonal, anti-human, rat