CD105 Picoband polyclonal, anti-human, mouse, rat

CD105 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10274
Catalog Number: AC-ABO10274
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Endoglin(ENG) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Endoglin

Protein Function:
Major glycoprotein of vascular endothelium. Involved in the regulation of angiogenesis. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. Acts as TGF-beta coreceptor and is involved in the TGF- beta/BMP signaling cascade. Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGF-beta1 signaling through SMAD3. .

Other Names: Endoglin, CD105, ENG, END

Subcellular Localization: Membrane; Single-pass type I membrane protein.

Tissue Specificity: Endoglin is restricted to endothelial cells in all tissues except bone marrow.

Gene ID: 2022

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CD105 (258-297aa YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ), different from the related mouse sequence by twelve amino acids.

Calculated MW: 70578

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CD105 Picoband polyclonal, anti-human, mouse, rat