CD11b polyclonal, anti-mouse antibody

CD11b polyclonal, anti-mouse antibody

€270.00
In stock
SKU
AC-ABO11246
Catalog Number: AC-ABO11246
Size: 100 µg
Host: rabbit IgG
Applications: WB
Datasheet

Request Information
Description: Rabbit IgG polyclonal antibody for Inhibitor of growth protein 1 (ING1) detection. Tested with WB in human.

Protein Name: Inhibitor of growth protein 1

Background:
Cooperates with p53/TP53 in the negative regulatory pathway of cell growth by modulating p53-dependent transcriptional activation. Implicated as a tumor suppressor gene. .

Other Names:
Inhibitor of growth protein 1, ING1

Subcellular Localization: Nucleus .

Tissue Specificity: Isoform 2 was expressed in all normal tissues and cells examined, as well as in all breast cancer and melanoma cell lines examined. Isoform 3 was expressed in testis, liver, and kidney, weakly expressed in colon and brain and not expressed in breast and cultured melanocytes. Isoform 4 was highly expressed in testis and weakly expressed in brain, but not expressed in breast, colon, kidney, melanocytes, breast cancer or melanoma cell lines. .

Gene ID: 3621

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ING1 (192-223aa KELDECYERFSRETDGAQKRRMLHCVQRALIR), different from the related mouse sequence by seven amino acids.

Calculated MW: 46738

Purification: Immunogen affinity purified.

Format: Lyophilized

Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.

Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CD11b polyclonal, anti-mouse antibody