CD140a (PDGF Receptor alpha) polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
PDGFRA (Platelet-derived growth factor receptor, alpha), also called PDGFR2, encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The PDGFA gene is mapped on 4q12. The PDGFRA-FIP1L1 gene is a constitutively activated tyrosine kinase that transforms hematopoietic cells and is a therapeutic target of imatinib. And the PDGFRA gene contains 23 exons spanning about 65 kb. Using the human PDGFRA promoter linked to a luciferase reporter, Joosten et al. showed that PAX1 acts as a transcriptional activator of the PDGFRA gene in differentiated human embryonal carcinoma cells. PDGFRA is responsible for mediating cellular contraction of multiple growth factors: TGFB1 and members of the PDGF family. Lei et al. noted that in the rabbit model of the disease, PDGFRA is dramatically more capable of promoting PVR than is the closely related PDGFRB. PDGFRA is a critical receptor required for human CMV infection, and thus a target for novel antiviral therapies.

Description:
Rabbit IgG polyclonal antibody for Platelet-derived growth factor receptor alpha (PDGFRA) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
Alpha platelet derived growth factor receptor antibody, Alpha-type platelet-derived growth factor receptor antibody, CD 140a antibody, CD140 antigen-like family member A antibody, CD140a antibody, CD140a antigen antibody, MGC74795 antibody, PDGF alpha chain antibody, PDGF R alpha antibody, PDGF-R-alpha antibody, PDGFR 2 antibody, PDGFR A antibody, PDGFR alpha antibody, PDGFR2 antibody, PDGFRA antibody, PDGFRA/BCR fusion antibody, PGFRA_HUMAN antibody, Platelet derived growth factor receptor 2 antibody, Platelet derived growth factor receptor alpha antibody, Platelet derived growth factor receptor alpha polypeptide antibody, Platelet derived growth factor receptor antibody, Rearranged in hypereosinophilia platelet derived growth factor receptor alpha fusion protein antibody, RHEPDGFRA antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human PDGFRA (968-1002aa DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.