CD18 polyclonal, anti-human
€354.00
In stock
SKU
ARP-10-P1124
Quantity: 100 µg
Background:
The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the “inside-out” signaling pathways.
Description:
Rabbit IgG polyclonal antibody for Integrin beta-2 (ITGB2) detection. Tested with WB, IHC-P in Human.
Synonyms:
95 subunit beta antibody, CD 18 antibody, CD18 antibody, Cell surface adhesion glycoprotein LFA 1/CR3/P150,959 beta subunit precursor) antibody, Cell surface adhesion glycoproteins LFA 1/CR3/p150,95 subunit beta antibody, Cell surface adhesion glycoproteins LFA-1/CR3/p150 antibody, Complement receptor C3 beta subunit antibody, Complement receptor C3 subunit beta antibody, Integrin beta 2 antibody, Integrin beta chain beta 2 antibody, Integrin beta-2 antibody, Integrin, beta 2(complement component 3 receptor 3 and 4 subunit) antibody, ITB2_HUMAN antibody, ITGB2 antibody, LAD antibody, LCAMB antibody, Leukocyte associated antigens CD18/11A, CD18/11B, CD18/11C antibody, Leukocyte cell adhesion molecule CD18 antibody, LFA 1 antibody, LFA1 antibody, Lymphocyte function associated antigen 1 antibody, MAC 1 antibody, MAC1 antibody, MF17 antibody, MFI7 antibody, OTTHUMP00000115278 antibody, OTTHUMP00000115279 antibody, OTTHUMP00000115280 antibody, OTTHUMP00000115281 antibody, OTTHUMP00000115282 antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human CD18(24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review