CD19 Picoband polyclonal, anti-human

CD19 Picoband polyclonal, anti-human

€455.00
In stock
SKU
AC-ABO12486
Catalog Number: AC-ABO12486
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for B-lymphocyte antigen CD19(CD19) detection. Tested with WB, IHC-P in Human.Protein Name: B-lymphocyte antigen CD19

Protein Function:
Assembles with the antigen receptor of B-lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.

Other Names: B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, Differentiation antigen CD19, T-cell surface antigen Leu-12, CD19, CD19

Subcellular Localization: Membrane; Single-pass type I membrane protein.

Gene ID: 930

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CD19 (307-337aa LVGILHLQRALVLRRKRKRMTDPTRRFFKVT), different from the related mouse sequence by seven amino acids.

Calculated MW: 61128

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CD19 Picoband polyclonal, anti-human