CD19 Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO12486
Catalog Number: AC-ABO12486
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for B-lymphocyte antigen CD19(CD19) detection. Tested with WB, IHC-P in Human.Protein Name: B-lymphocyte antigen CD19
Protein Function:
Assembles with the antigen receptor of B-lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
Other Names: B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, Differentiation antigen CD19, T-cell surface antigen Leu-12, CD19, CD19
Subcellular Localization: Membrane; Single-pass type I membrane protein.
Gene ID: 930
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CD19 (307-337aa LVGILHLQRALVLRRKRKRMTDPTRRFFKVT), different from the related mouse sequence by seven amino acids.
Calculated MW: 61128
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Assembles with the antigen receptor of B-lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
Other Names: B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, Differentiation antigen CD19, T-cell surface antigen Leu-12, CD19, CD19
Subcellular Localization: Membrane; Single-pass type I membrane protein.
Gene ID: 930
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CD19 (307-337aa LVGILHLQRALVLRRKRKRMTDPTRRFFKVT), different from the related mouse sequence by seven amino acids.
Calculated MW: 61128
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review