CD19 polyclonal, anti-human
€384.00
In stock
SKU
ARP-10-P9800
Quantity: 100 µg
Background:
B-lymphocyte antigen CD19, also known as CD19 (Cluster of Differentiation 19), is a protein that in humans is encoded by the CD19 gene. It is found on the surface of B-cells, a type of white blood cell. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. The CD19 gene encodes a cell surface molecule that assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
Description:
Rabbit IgG polyclonal antibody for B-lymphocyte antigen CD19 (CD19) detection. Tested with WB, IHC-P in Human.
Synonyms:
Antibody deficiency due to defect in CD19, included antibody, AW495831 antibody, B lymphocyte antigen CD19 antibody, B lymphocyte surface antigen B4 antibody, B-lymphocyte antigen CD19 antibody, B-lymphocyte surface antigen B4 antibody, B4 antibody, CD19 antibody, CD19 antigen antibody, CD19 molecule antibody, Cd19 protein antibody, CD19_HUMAN antibody, CVID3 antibody, Differentiation antigen CD19 antibody, Leu 12 antibody, Leu-12 antibody, Leu12 antibody, MGC109570 antibody, MGC12802 antibody, T-cell surface antigen Leu-12 antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human CD19 (307-337aa LVGILHLQRALVLRRKRKRMTDPTRRFFKVT), different from the related mouse sequence by seven amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review