CD243 (P Glycoprotein) polyclonal, anti-human, mouse, rat
€354.00
In stock
SKU
ARP-10-R1034
Quantity: 100 µg
Background:
P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood–brain barrier.
Description:
Rabbit IgG polyclonal antibody for Multidrug resistance protein 1 (ABCB1) detection. Tested with IHC-P, IHC-F in Human, Mouse, Rat.
Synonyms:
ABC20 antibody, ABCB1 antibody, ATP binding cassette, sub family B (MDR/TAP), member 1 antibody, ATP-binding cassette sub-family B member 1 antibody, CD243 antibody, CLCS antibody, Colchicin sensitivity antibody, Doxorubicin resistance antibody, GP170 antibody, MDR1 antibody, MDR1_HUMAN antibody, Multidrug resistance 1 antibody, Multidrug resistance protein 1 antibody, P glycoprotein 1 antibody, P gp antibody, P-glycoprotein 1 antibody, PGY1 antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, mouse, rat
Applications: IHC-P, IHC-F
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review