CD256 (APRIL) polyclonal, anti-human

CD256 (APRIL) polyclonal, anti-human

€384.00
In stock
SKU
ARP-10-P9523
Catalog Number: 10-P9523
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
A proliferation-inducing ligand (APRIL), also known as tumor necrosis factor ligand superfamily member 13 (TNFSF13), is a protein of the TNF superfamily recognized by the cell surface receptor TACI. The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. And this protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.

Description:
Rabbit IgG polyclonal antibody for Tumor necrosis factor ligand superfamily member 13 (TNFSF13) detection. Tested with WB, ELISA in Human.

Synonyms:
A proliferation inducing ligand antibody, A proliferation-inducing ligand antibody, APRIL antibody, CD 256 antibody, CD256 antibody, CD256 antigen antibody, Ligand antibody, PRO715 antibody, Proliferation inducing ligand APRIL antibody, TALL 2 antibody, TALL-2 antibody, TALL2 antibody, TNF and APOL related leukocyte expressed ligand 2 antibody, TNF related death ligand 1 antibody, TNF related death ligand antibody, TNF- and APOL-related leukocyte expressed ligand 2 antibody, TNF-related death ligand 1 antibody, TNF13_HUMAN antibody, TNFSF 13 antibody, TNFSF13 antibody, TNFSF13 protein antibody, TRDL 1 antibody, TRDL-1 antibody, TRDL1 antibody, Tumor necrosis factor (ligand) superfamily member 13 antibody, Tumor necrosis factor (ligand) superfamily, member 13 antibody, Tumor necrosis factor ligand superfamily member 13 antibody, Tumor necrosis factor like protein ZTNF2 antibody, Tumor necrosis factor related death ligand antibody, Tumor necrosis factor related death ligand 1 antibody, Tumor necrosis factor superfamily member 13 antibody, TWE PRIL antibody, UNQ383 antibody, UNQ383/ PRO715 antibody, ZTNF 2 antibody, ZTNF2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB, ELISA

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CD256 (APRIL) polyclonal, anti-human