CD26 polyclonal, anti-human, rat

Quantity: 100 µg

Background:
Dipeptidyl peptidase-4 (DPP4), also known as CD26 (cluster of differentiation 26) is a protein that, in humans, is encoded by the DPP4 gene. The protein encoded by the DPP4 gene is an antigenic enzyme expressed on the surface of most cell types and is associated with immune regulation, signal transduction and apoptosis. Also, it is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. DPP4 plays a major role in glucose metabolism. It is responsible for the degradation ofincretins such as GLP-1. Furthermore, it appears to work as a suppressor in the development of cancer andtumours.

Description:
Rabbit IgG polyclonal antibody for Dipeptidyl peptidase 4 (DPP4) detection. Tested with WB in Human, Rat.

Synonyms:
CD26 antigen antibody, ADA-binding protein antibody, ADABP antibody, ADCP 2 antibody, ADCP-2 antibody, ADCP2 antibody, Adenosine deaminase complexing protein 2 antibody, CD 26 antibody, CD26 antibody, CD26 antigen 3 antibody, Dipeptidyl peptidase 4 antibody, Dipeptidyl peptidase 4 soluble form antibody, Dipeptidyl peptidase IV antibody, Dipeptidyl peptidase IV membrane form antibody, Dipeptidyl peptidase IV soluble form antibody, Dipeptidyl peptidase, intestinal antibody, Dipeptidylpeptidase 4 antibody, Dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2) antibody, Dipeptidylpeptidase IV antibody, DPP 4 antibody, DPP IV antibody, DPP IV estoenzyme antibody, DPP4 antibody, DPP4_HUMAN antibody, DPPIV antibody, Intestinal dipeptidyl peptidase antibody, T cell activation antigen CD26 antibody, T-cell activation antigen CD26 antibody, TP 103 antibody, TP103 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human CD26 (731-761aa QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ), different from the related mouse and rat sequences by three amino acids.A synthetic peptide corresponding to a sequence at the C-terminus of human CD26 (731-761aa QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ), different from the related mouse and rat sequences by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.