CD338 (BCRP, ABCG2) polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
ABCG2(Atp-binding cassette, subfamily g, member 2) also known as ABCP, BCRP or MRX, is a protein that in humans is encoded by the ABCG2 gene. The ABCG2 gene encodes a membrane transporter belonging to the ATP-binding cassette (ABC) superfamily of membrane transporters, which are involved in the trafficking of biologic molecules across cell membranes. The ABCG2 protein is also a high capacity transporter for uric acid excretion in the kidney, liver, and gut. The ABCG2 gene is mapped on 4q22.1. In vitro assays of isolated membrane preparations revealed a high-capacity, vanadate-sensitive ATPase activity associated with ABCG2 expression that was stimulated by compounds known to be transported by this protein. Ozvegy et al. (2001) concluded that ABCG2 is likely functioning as a homodimer or homooligomer in this expression system since it is unlikely that putative Sf9 transport partners would be overexpressed at similarly high levels.Abcg2 transports pheophorbide-a, which occurs in various plant-derived foods and food supplements and is highly efficient in limiting its uptake from ingested food. ABCG2 is a major factor in the concentrative transfer of drugs, carcinogens, and dietary toxins to the milk of mice, cows, and humans.

Description:
Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family G member 2 (ABCG2) detection. Tested with WB, IHC-P, IHC-F in Human, Mouse, Rat.

Synonyms:
ABC transporter antibody, ABC15 antibody, ABCG 2 antibody, ABCG2 antibody, ABCG2_HUMAN antibody, ABCP antibody, ATP binding cassette sub family G (WHITE) member 2 antibody, ATP binding cassette transporter G2 antibody, ATP-binding cassette sub-family G member 2 antibody, BCRP antibody, BCRP1 antibody, BMDP antibody, Breast cancer resistance protein antibody, CD338 antibody, CDw338 antibody, CDw338 antigen antibody, EST157481 antibody, GOUT1 antibody, MGC102821 antibody, Mitoxantrone resistance associated protein antibody, Mitoxantrone resistance-associated protein antibody, MRX antibody, Multi drug resistance efflux transport ATP binding cassette sub family G (WHITE) member 2 antibody, MXR antibody, MXR1 antibody, Placenta specific ATP binding cassette transporter antibody, Placenta specific MDR protein antibody, Placenta-specific ATP-binding cassette transporter antibody, UAQTL1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human ABCG2(137-168aa RENLQFSAALRLATTMTNHEKNERINRVIQEL), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P, IHC-F

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.