CD36 polyclonal, anti-human, mouse, rat
€384.00
In stock
SKU
ARP-10-P9371
Quantity: 100 µg
Background:
CD36 (cluster of differentiation 36), also known as FAT (fatty acid translocase), FAT/CD36, (FAT)/CD36, SCARB3, GP88, glycoprotein IV (gpIV), and glycoprotein IIIb (gpIIIb), is anintegral membrane protein found on the surface of many cell types in vertebrate animals. CD36 is a member of the class B scavenger receptor family of cell surface proteins. It is mapped to 7q21.11. And CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. In addition, CD36 function in long-chain fatty acid uptake and signaling can be irreversibly inhibited by sulfo-N-succinimidyl oleate (SSO), which binds lysine 164 within a hydrophobic pocked shared by several CD36 ligands, e.g. fatty acid and oxLDL.
Description:
Rabbit IgG polyclonal antibody for Platelet glycoprotein 4 (CD36) detection. Tested with WB, IHC-P in Human, Mouse, Rat.
Synonyms:
Adipocyte membrane protein antibody, CD36 antibody, CD36 antibody, CD36 antigen (collagen type I receptor, thrombospondin receptor) antibody, CD36 antigen antibody, CD36 molecule (thrombospondin receptor) antibody, CD36 molecule antibody, CD36_HUMAN antibody, CHDS7 antibody, Cluster determinant 36 antibody, Collagen receptor, platelet antibody, FAT antibody, Fatty acid translocase antibody, Fatty acid transport protein antibody, Glycoprotein IIIb antibody, GP IIIb antibody, GP3B antibody, GP4 antibody, GPIIIB antibody, GPIV antibody, Leukocyte differentiation antigen CD36 antibody, MGC108510 antibody, MGC91634 antibody, PAS 4 protein antibody, PAS IV antibody, PAS-4 antibody, PASIV antibody, Platelet collagen receptor antibody, Platelet glycoprotein 4 antibody, Platelet glycoprotein IV antibody, scarb3 antibody, Scavenger receptor class B member 3 antibody, Thrombospondin receptor antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, mouse, rat
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review