CD36L1 (SCARB1) polyclonal, anti-mouse, rat

Quantity: 100 µg

Background:
Scavenger receptor class B member 1 (SRB1), also known as SR-BI, is a protein that in humans is encoded by the SCARB1 gene. SR-BI functions as a receptor for high-density lipoprotein. Scavenger receptor class B, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, including the liver and adrenal. It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver. This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion. This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, which is the principal cause of heart disease and stroke. SR-BI has also been identified in the livers of non-mammalian species (turtle, goldfish, shark, chicken, frog, and skate), suggesting it emerged early in vertebrate evolutionary history. The turtle also seems to upregulate SB-RI during egg development, indicating that cholesterol efflux may be at peak levels during developmental stages.

Description:
Rabbit IgG polyclonal antibody for Scavenger receptor class B member 1 (SCARB1) detection. Tested with WB in Mouse, Rat.

Synonyms:
CD36 AND LIMPII ANALOGOUS 1 antibody, CD36 antibody, CD36 Antigen like 1 antibody, CD36 antigen-like 1 antibody, CD36L1 antibody, CLA 1 antibody, CLA-1 antibody, CLA1 antibody, Collagen type I receptor antibody, HDLQTL6 antibody, MGC138242 antibody, SCARB1 antibody, Scavebger Receptor Class B Member 1 antibody, Scavenger receptor class B member 1 antibody, Scavenger Receptor Class B Type 1 antibody, SCRB1_HUMAN antibody, SR BI antibody, SR-BI antibody, SRB1 antibody, SRBI antibody, Thrombospondin receptor like 1 antibody, thrombospondin receptor-like 1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.