CD41 (ITGA2B) polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.

Description:
Rabbit IgG polyclonal antibody for Integrin alpha-Iib (ITGA2B) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
antigen CD41 antibody, BDPLT16 antibody, BDPLT2 antibody, CD41 antibody, CD41B antibody, form 2 antibody, GP2B antibody, GPalpha IIb antibody, GPIIb antibody, GT antibody, GTA antibody, HPA3 antibody, Integrin alpha 2b antibody, Integrin alpha IIb antibody, Integrin alpha-IIb light chain antibody, Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) antibody, ITA2B_HUMAN antibody, ITGA2B antibody, ITGAB antibody, platelet fibrinogen receptor, alpha subunit antibody, platelet glycoprotein IIb of IIb/IIIa complex antibody, Platelet membrane glycoprotein IIb antibody, platelet specific antigen BAK antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.