CD45 (B220) polyclonal, anti-human
€384.00
In stock
SKU
ARP-10-P9785
Quantity: 100 µg
Background:
CD45 (Cluster of Differentiation 45), also known as PTPRC, LCA or CD45R, is an enzyme that, in humans, is encoded by the PTPRC gene. It is a member of the protein tyrosine phosphatase (PTP) family. CD45 is a major high molecular mass leukocyte cell surface molecule which is also an integral membrane protein tyrosine phosphatase. The cytogenetic location of CD45 is 1q31.3-q32.1. This gene is especially a prototype for transmembrane protein-tyrosine phosphatase (PTP). Targeted disruption of the CD45 gene leads to enhanced cytokine and interferon receptor-mediated activation of JAKs and STAT proteins. In vitro, CD45 directly dephosphorylates and binds to JAKs. Functionally, CD45 negatively regulates interleukin-3-mediated cellular proliferation, erythropoietin-dependent hematopoiesis, and antiviral responses in vitro and in vivo. In addition, CD45 has been best studied in T cells, where it determines T cell receptor signaling thresholds. CD45 is moved into or out of the immunological synapse (IS) membrane microdomain depending on the relative influence of interaction with the extracellular galectin lattice or the intracellular actin cytoskeleton. Galectin interaction can be finetuned by varying usage of the heavily Oglycosylated spliced regions and sialylation of Nlinked carbohydrates.
Description:
Rabbit IgG polyclonal antibody for Receptor-type tyrosine-protein phosphatase C (PTPRC) detection. Tested with WB, IHC-P in Human.
Synonyms:
B220 antibody, CD 45 antibody, CD45 antibody, CD45 antigen antibody, CD45R antibody, GP180 antibody, L CA antibody, L-CA antibody, LCA antibody, Leukocyte common antigen antibody, loc antibody, Ly-5 antibody, LY5 antibody, Lyt-4 antibody, OTTHUMP00000033813 antibody, OTTHUMP00000033816 antibody, OTTHUMP00000033817 antibody, OTTHUMP00000038574 antibody, Protein tyrosine phosphatase receptor type C antibody, Protein tyrosine phosphatase receptor type c polypeptide antibody, protein tyrosine phosphatase, receptor type, C antibody, PTPRC antibody, PTPRC_HUMAN antibody, Receptor-type tyrosine-protein phosphatase C antibody, SCID due to PTPRC deficiency antibody, T200 antibody, T200 glycoprotein antibody, T200 leukocyte common antigen antibody.
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human CD45(1214-1254aa EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK), different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review