CD45 Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO12471
Catalog Number: AC-ABO12471
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Receptor-type tyrosine-protein phosphatase C(PTPRC) detection. Tested with WB, IHC-P in Human.Protein Name: Receptor-type tyrosine-protein phosphatase C
Protein Function:
Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity (By similarity). .
Other Names: Receptor-type tyrosine-protein phosphatase C, 3.1.3.48, Leukocyte common antigen, L-CA, T200, CD45, PTPRC, CD45
Subcellular Localization: Membrane ; Single-pass type I membrane protein . Membrane raft . Colocalized with DPP4 in membrane rafts.
Gene ID: 5788
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD45(1214-1254aa EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK), different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids.
Calculated MW: 147486
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity (By similarity). .
Other Names: Receptor-type tyrosine-protein phosphatase C, 3.1.3.48, Leukocyte common antigen, L-CA, T200, CD45, PTPRC, CD45
Subcellular Localization: Membrane ; Single-pass type I membrane protein . Membrane raft . Colocalized with DPP4 in membrane rafts.
Gene ID: 5788
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD45(1214-1254aa EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK), different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids.
Calculated MW: 147486
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review