CD46 Picoband polyclonal, anti-mouse
€455.00
In stock
SKU
AC-ABO12534
Catalog Number: AC-ABO12534
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Membrane cofactor protein(CD46) detection. Tested with WB in Mouse.Protein Name: Membrane cofactor protein
Protein Function:
May be involved in the fusion of the spermatozoa with the oocyte during fertilization. .
Other Names: Membrane cofactor protein, CD46, Cd46, Mcp
Subcellular Localization: Isoform 1: Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein. Inner acrosomal membrane of spermatozoa.
Tissue Specificity: Present only in testis (at protein level). .
Gene ID: 17221
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids.
Calculated MW: 40881
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
May be involved in the fusion of the spermatozoa with the oocyte during fertilization. .
Other Names: Membrane cofactor protein, CD46, Cd46, Mcp
Subcellular Localization: Isoform 1: Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein. Inner acrosomal membrane of spermatozoa.
Tissue Specificity: Present only in testis (at protein level). .
Gene ID: 17221
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids.
Calculated MW: 40881
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review