CD46 polyclonal, anti-mouse

CD46 polyclonal, anti-mouse

€384.00
In stock
SKU
ARP-10-P9848
Catalog Number: 10-P9848
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
CD46 complement regulatory protein, also known as CD46 (cluster of differentiation 46) and Membrane Cofactor Protein, is a protein which in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described. 

Description:
Rabbit IgG polyclonal antibody for Membrane cofactor protein (CD46) detection. Tested with WB in Mouse.

Synonyms:
AHUS2 antibody, Antigen defined by monoclonal antibody, TRA 2 10 antibody, Antigen identified by monoclonal antibody, TRA 2 10 antibody, CD46 antibody, CD46 antigen antibody, CD46 antigen complement regulatory protein antibody, CD46 molecule antibody, CD46 molecule complement regulatory protein antibody, Complement membrane cofactor protein antibody, MCP antibody, MCP_HUMAN antibody, Measles virus receptor antibody, membrane cofactor protein (CD46, trophoblast-lymphocyte cross-reactive antigen) antibody, Membrane cofactor protein antibody, MGC26544 antibody, MIC10 antibody, TLX antibody, TRA2.10 antibody, Trophoblast leucocyte common antigen antibody, Trophoblast leukocyte common antigen antibody, Trophoblast lymphocyte cross reactive antigen antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids.A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CD46 polyclonal, anti-mouse