CD49c (Integrin alpha 3A) (clone 158A3), anti-human

Background:
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.

Clone: 158A3

Isotype: Mouse IgG2a

Source: 158A3 is a Mouse monoclonal IgG2a antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Reactivity: human

Specificity: 158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A.

Form: Each vial contains 100 ul of 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.

Applications: Immunocytochemistry, Immunohistochemistry (frozen), Western blotting

Storage: Store at 4C, or in small aliquots at -20C.