CD61 (Integrin beta 3) polyclonal, anti-human, mouse, rat
€384.00
In stock
SKU
ARP-10-P9806
Quantity: 100 µg
Background:
ITGB3 (INTEGRIN, BETA-3), also called GP3A, GPIIIa, CD61, is a protein that in humans is encoded by the ITGB3 gene. It is a cluster of differentiation found on thrombocytes. This gene is mapped to 17q21.32. And the GP3A gene has 14 exons. The 3-prime exon is larger than 1,700 nucleotides and contains the 3-prime untranslated region. The ITGB3 complex belongs to the integrin class of cell adhesion molecule receptors that share a common heterodimeric structure with alpha and beta subunits. Additionally, the ITGB3 complex mediates platelet aggregation by acting as a receptor for fibrinogen. Although the ITGB3 is expressed on the cell surface at normal levels and is capable of function following extracellular stimulation, it could not be activated via the 'inside-out' signaling pathways.
Description:
Rabbit IgG polyclonal antibody for Integrin beta-3 (ITGB3) detection. Tested with WB, IHC-P in Human, Mouse, Rat.
Synonyms:
BDPLT2 antibody, CD 61 antibody, CD61 antibody, CD61 antigen antibody, GP3A antibody, GPIIIa antibody, GT antibody, HPA 1 antibody, HPA 4 antibody, Integrin beta 3 (platelet glycoprotein IIIa antigen CD61) antibody, Integrin beta chain beta 3 antibody, Integrin beta-3 antibody, ITB3_HUMAN antibody, ITG B3 antibody, ITGB 3 antibody, ITGB3 antibody, NAIT antibody, Platelet fibrinogen receptor beta subunit antibody, Platelet glycoprotein IIIa antibody, platelet glycoprotein IIIa precursor antibody, Platelet membrane glycoprotein IIIa antibody, PTP antibody.
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Integrin beta 3 (753-786aa FAKFEEERARAKWDTANNPLYKEATSTFTNITYR), identical to the related mouse and rat sequences
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, mouse, rat
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review