CD86/B7-2 polyclonal, anti-mouse antibody

CD86/B7-2 polyclonal, anti-mouse antibody

€270.00
In stock
SKU
AC-ABO10717
Catalog Number: AC-ABO10717
Size: 100 µg
Host: rabbit IgG
Applications: WB
Datasheet

Request Information
Description: Rabbit IgG polyclonal antibody for Cytochrome P450 2D6 (CYP2D6) detection. Tested with WB, IHC-P in human, mouse, rat.

Protein Name: Cytochrome P450 2D6

Background:
Responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. It is involved in the metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants. .

Other Names:
Cytochrome P450 2D6, 1.14.14.1, CYPIID6, Cholesterol 25-hydroxylase, Cytochrome P450-DB1, Debrisoquine 4-hydroxylase, CYP2D6, CYP2DL1

Subcellular Localization: Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.

Gene ID: 1565

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM).

Calculated MW: 55769

Purification: Immunogen affinity purified.

Format: Lyophilized

Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.

Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CD86/B7-2 polyclonal, anti-mouse antibody