Cdc25C Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO12535
Catalog Number: AC-ABO12535
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for M-phase inducer phosphatase 3(CDC25C) detection. Tested with WB in Human.Protein Name: M-phase inducer phosphatase 3
Protein Function:
Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity. .
Other Names: M-phase inducer phosphatase 3, 3.1.3.48, Dual specificity phosphatase Cdc25C, CDC25C
Subcellular Localization: Nucleus .
Gene ID: 995
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cdc25C (435-473aa MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP), different from the related mouse sequence by ten amino acids.
Calculated MW: 53365
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity. .
Other Names: M-phase inducer phosphatase 3, 3.1.3.48, Dual specificity phosphatase Cdc25C, CDC25C
Subcellular Localization: Nucleus .
Gene ID: 995
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cdc25C (435-473aa MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP), different from the related mouse sequence by ten amino acids.
Calculated MW: 53365
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review