Cdc25C polyclonal, anti-human

Quantity: 100 µg

Background:
M-phase inducer phosphatase 3 is an enzyme that in humans is encoded by the CDC25C gene. This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 (CDK1) and triggers entry into mitosis. Also, it is thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.

Description:
Rabbit IgG polyclonal antibody for M-phase inducer phosphatase 3 (CDC25C) detection. Tested with WB in Human.

Synonyms:
CDC 25 antibody, Cdc 25C antibody, CDC25 antibody, CDC25C antibody, Cell division cycle 25 homolog C antibody, Cell division cycle 25C antibody, Cell division cycle 25C protein antibody, Dual specificity phosphatase Cdc25C antibody, M phase inducer phosphatase 3 antibody, M-phase inducer phosphatase 3 antibody, Mitosis inducer CDC25 antibody, MPIP3 antibody, MPIP3_HUMAN antibody, Phosphotyrosine phosphatase antibody, PPP1R60 antibody, protein phosphatase 1, regulatory subunit 60 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Cdc25C (435-473aa MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP), different from the related mouse sequence by ten amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.