CDK5R1 polyclonal, anti-human

Quantity: 100 µg

Background:
CDK5R1 is also known as p35, CDK5R or NCK5A. The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease.

Description:
Rabbit IgG polyclonal antibody for Cyclin-dependent kinase 5 activator 1 (CDK5R1) detection. Tested with WB in Human.

Synonyms:
CD5R1_HUMAN antibody, CDK 5R1 antibody, CDK5 activator 1 antibody, CDK5P35 antibody, CDK5R antibody, CDK5R1 antibody, Cyclin dependent kinase 5 activator 1 antibody, Cyclin dependent kinase 5 regulatory subunit 1 antibody, Cyclin-dependent kinase 5 activator 1 antibody, Cyclin-dependent kinase 5 regulatory subunit 1 antibody, MGC33831 antibody, NCK 5A antibody, NCK5A antibody, Neuronal CDK5 activator antibody, p23 antibody, p25 antibody, p25 included antibody, p35 antibody, p35nck5a antibody, Regulatory partner for CDK5 kinase antibody, Tau protein kinase II 23 kDa subunit antibody, Tau protein kinase II 23kDa subunit antibody, TPKII regulatory subunit antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human CDK5R1 (11-44aa YRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRH), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.