Chk1 polyclonal, anti-human, mouse, rat antibody
€270.00
In stock
SKU
AC-ABO10766
Description: Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH) detection. Tested with WB, IHC-P in human, mouse, rat.
Protein Name: Dihydroorotate dehydrogenase (quinone), mitochondrial
Background:
Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.
Other Names:
Dihydroorotate dehydrogenase (quinone), mitochondrial, DHOdehase, 1.3.5.2, Dihydroorotate oxidase, DHODH
Subcellular Localization: Mitochondrion inner membrane ; Single-pass membrane protein .
Gene ID: 1723
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D), different from the related mouse sequence by four amino acids, and from the related rat sequence by two amino acids.
Calculated MW: 42867
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Name: Dihydroorotate dehydrogenase (quinone), mitochondrial
Background:
Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.
Other Names:
Dihydroorotate dehydrogenase (quinone), mitochondrial, DHOdehase, 1.3.5.2, Dihydroorotate oxidase, DHODH
Subcellular Localization: Mitochondrion inner membrane ; Single-pass membrane protein .
Gene ID: 1723
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D), different from the related mouse sequence by four amino acids, and from the related rat sequence by two amino acids.
Calculated MW: 42867
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review