Chk1 polyclonal, anti-human, mouse, rat antibody

Chk1 polyclonal, anti-human, mouse, rat antibody

€270.00
In stock
SKU
AC-ABO10766
Catalog Number: AC-ABO10766
Size: 100 µg
Host: rabbit IgG
Applications: WB
Datasheet

Request Information
Description: Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH) detection. Tested with WB, IHC-P in human, mouse, rat.

Protein Name: Dihydroorotate dehydrogenase (quinone), mitochondrial

Background:
Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

Other Names:
Dihydroorotate dehydrogenase (quinone), mitochondrial, DHOdehase, 1.3.5.2, Dihydroorotate oxidase, DHODH

Subcellular Localization: Mitochondrion inner membrane ; Single-pass membrane protein .

Gene ID: 1723

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D), different from the related mouse sequence by four amino acids, and from the related rat sequence by two amino acids.

Calculated MW: 42867

Purification: Immunogen affinity purified.

Format: Lyophilized

Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.

Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Chk1 polyclonal, anti-human, mouse, rat antibody