Chk2 polyclonal, anti-human, mouse, rat

Chk2 polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9692
Catalog Number: 10-P9692
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
CHK2, a protein kinase that is activated in response to DNA damage, is involved in cell cycle arrest. Mapped on 22q12.1, CHK2 has a potential regulatory region rich in SQ and TQ amino acid pairs. It regulates BRCA1 function after DNA damage by phosphorylating serine-988 of BRCA1. Additionally, CHK2 can be modified by phosphorylation and activated in response to ionizing radiation, and can be also modified in response to hydroxyurea treatment. Furthermore, oligomerization of CHEK2 increases the efficiency of transautophosphorylation, resulting in the release of active CHEK2 monomers that proceed to enforce checkpoint control in irradiated cells. Moreover, CHK2 is a tumor suppressor gene conferring predisposition to sarcoma, breast cancer, and brain tumors, and that their observations provided a link between the central role of p53 inactivation in human cancer and the well-defined G2 checkpoint in yeast. There is a wide expression of small amounts of CHK2 mRNA with larger amounts in human testis, spleen, colon, and peripheral blood leukocytes.

Description:
Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2 (CHEK2) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
bA444G7 antibody, CDS 1 antibody, CDS1 antibody, Checkpoint kinase 2 antibody, Checkpoint like protein CHK2 antibody, Chek 2 antibody, Chek2 antibody, Chk 2 antibody, CHK2 checkpoint homolog (S. pombe) antibody, CHK2 checkpoint homolog antibody, CHK2_HUMAN antibody, HuCds 1 antibody, HuCds1 antibody, LFS 2 antibody, LFS2 antibody, PP1425 antibody, RAD 53 antibody, RAD53 antibody, Rad53 homolog antibody, Serine/threonine protein kinase Chk2 antibody, Serine/ threonine-protein kinase Chk2 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL), different from the related mouse sequence by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Chk2 polyclonal, anti-human, mouse, rat