Cyclin D1 (clone DCS-6), anti-human, mouse, rat antibody
€310.00
In stock
SKU
AC-ABO10425
Catalog Number: AC-ABO10425
Size: 100 µg
Host: Mouse IgG2a
Applications: WB, IHC-P, IHC-F, ICC
Datasheet
Request Information
Size: 100 µg
Host: Mouse IgG2a
Applications: WB, IHC-P, IHC-F, ICC
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Calpastatin (CAST) detection. Tested with WB, IHC-P in human.
Protein Name: Calpastatin
Background:
Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.
Other Names:
Calpastatin, Calpain inhibitor, Sperm BS-17 component, CAST
Subcellular Localization:
Gene ID: 831
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin (275-310aa QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by eleven amino
Calculated MW: 76573
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Name: Calpastatin
Background:
Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.
Other Names:
Calpastatin, Calpain inhibitor, Sperm BS-17 component, CAST
Subcellular Localization:
Gene ID: 831
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin (275-310aa QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by eleven amino
Calculated MW: 76573
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review