Cyclin D2 polyclonal, anti-human, mouse, rat antibody

Cyclin D2 polyclonal, anti-human, mouse, rat antibody

€270.00
In stock
SKU
AC-ABO10603
Catalog Number: AC-ABO10603
Size: 100 µg
Host: rabbit IgG
Applications: WB
Datasheet

Request Information
Description: Rabbit IgG polyclonal antibody for Copper chaperone for superoxide dismutase (CCS) detection. Tested with WB, IHC-P in human, mouse, rat.

Protein Name: Copper chaperone for superoxide dismutase

Background:
Delivers copper to copper zinc superoxide dismutase (SOD1).

Other Names:
Copper chaperone for superoxide dismutase, Superoxide dismutase copper chaperone, CCS

Subcellular Localization: Cytoplasm .

Tissue Specificity: Ubiquitous.

Gene ID: 9973

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCS (174-209aa DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.

Calculated MW: 29041

Purification: Immunogen affinity purified.

Format: Lyophilized

Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.

Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Cyclin D2 polyclonal, anti-human, mouse, rat antibody