Cyclin D2 polyclonal, anti-human, mouse, rat antibody
€270.00
In stock
SKU
AC-ABO10603
Description: Rabbit IgG polyclonal antibody for Copper chaperone for superoxide dismutase (CCS) detection. Tested with WB, IHC-P in human, mouse, rat.
Protein Name: Copper chaperone for superoxide dismutase
Background:
Delivers copper to copper zinc superoxide dismutase (SOD1).
Other Names:
Copper chaperone for superoxide dismutase, Superoxide dismutase copper chaperone, CCS
Subcellular Localization: Cytoplasm .
Tissue Specificity: Ubiquitous.
Gene ID: 9973
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCS (174-209aa DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
Calculated MW: 29041
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Name: Copper chaperone for superoxide dismutase
Background:
Delivers copper to copper zinc superoxide dismutase (SOD1).
Other Names:
Copper chaperone for superoxide dismutase, Superoxide dismutase copper chaperone, CCS
Subcellular Localization: Cytoplasm .
Tissue Specificity: Ubiquitous.
Gene ID: 9973
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCS (174-209aa DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
Calculated MW: 29041
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review