DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) (clone DG1/447 + DOG-1.1), anti-human
€0.00
In stock
SKU
ARP-24-55107-MSM3
Catalog Number: 24-55107-MSM3
Size: 100 µl, 0.5 ml, 1 ml
Isotype: Mouse IgG's
Size: 100 µl, 0.5 ml, 1 ml
Isotype: Mouse IgG's
Decription:
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Synonyms: Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein 1,TAOS2, ORAOV2, TMEM16A
Clone: DG1/447 + DOG-1.1
Isotype: Mouse IgG's
Immunogen: Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Reactivity: human. Others not known.
Form: Purified, in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Applications: Flow Cytometry (0.5-1ug/million cells in 0.1ml)
Immunofluorescence (0.5-1ug/ml)
Immunohistology (Formalin-fixed) (0.25-0.5ug/ml for 30 minutes at RT)
(Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes)
Optimal dilution for a specific application should be determined.
Reactivity: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Concentration: 0.2mg/ml
Storage: Can be stored at +4C. For long term storage, aliquot and store at -20C. Avoid repeated freezing and thawing cycles.
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Synonyms: Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein 1,TAOS2, ORAOV2, TMEM16A
Clone: DG1/447 + DOG-1.1
Isotype: Mouse IgG's
Immunogen: Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Reactivity: human. Others not known.
Form: Purified, in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Applications: Flow Cytometry (0.5-1ug/million cells in 0.1ml)
Immunofluorescence (0.5-1ug/ml)
Immunohistology (Formalin-fixed) (0.25-0.5ug/ml for 30 minutes at RT)
(Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes)
Optimal dilution for a specific application should be determined.
Reactivity: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Concentration: 0.2mg/ml
Storage: Can be stored at +4C. For long term storage, aliquot and store at -20C. Avoid repeated freezing and thawing cycles.
| Is Featured? | No |
|---|
Write Your Own Review