FMRP Picoband polyclonal, anti-human, mouse, rat

FMRP Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12389
Catalog Number: AC-ABO12389
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Synaptic functional regulator FMR1(FMR1) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Synaptic functional regulator FMR1

Protein Function:
Translation repressor. Component of the CYFIP1-EIF4E- FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit mediates translation repression (By similarity). RNA- binding protein that plays a role in intracellular RNA transport and in the regulation of translation of target mRNAs. Associated with polysomes. May play a role in the transport of mRNA from the nucleus to the cytoplasm. Binds strongly to poly(G), binds moderately to poly(U) but shows very little binding to poly(A) or poly(C). .

Other Names: Synaptic functional regulator FMR1, Fragile X mental retardation protein 1 {ECO:0000312|HGNC:HGNC:3775}, FMRP, Protein FMR-1, FMR1 (HGNC:3775)

Subcellular Localization: Cytoplasm . Nucleus . Nucleus, nucleolus .

Tissue Specificity: Highest levels found in neurons, brain, testis, placenta and lymphocytes. Also expressed in epithelial tissues and at very low levels in glial cells. .

Gene ID: 2332

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM), different from the related mouse and rat sequences by one amino acid.

Calculated MW: 71174

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:FMRP Picoband polyclonal, anti-human, mouse, rat