GJA3 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).

Description:
Rabbit IgG polyclonal antibody for Gap junction alpha-3 protein (GJA3) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
CAE3 antibody, Connexin 46 antibody, Connexin-46 antibody, Connexin46 antibody, Cx46 antibody, CXA3_HUMAN antibody, CZP3 antibody, Gap junction alpha 3 protein antibody, Gap junction alpha-3 protein antibody, Gap junction protein, alpha 3, 46kD (connexin 46) antibody, Gap junction protein, alpha 3, 46kDa (connexin 46) antibody, Gap junction protein, alpha 3, 46kDa antibody, Gja3 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human GJA3 (89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.