GNAQ polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.

Description:
Rabbit IgG polyclonal antibody for Guanine nucleotide-binding protein G (q) subunit alpha (GNAQ) detection. Tested with WB, IHC-P in Human, Rat, Mouse.

Synonyms:
CMC1 antibody, G alpha Q antibody, G protein alpha Q antibody, G-ALPHA-q antibody, GAQ antibody, GNAQ antibody, GNAQ_HUMAN antibody, guanine nucleotide binding protein (G protein), q polypeptide antibody, Guanine nucleotide binding protein alpha q antibody, guanine nucleotide binding protein G protein q polypeptide antibody, Guanine nucleotide binding protein G q subunit alpha antibody, Guanine nucleotide-binding protein alpha-q antibody, Guanine nucleotide-binding protein G(q) subunit alpha antibody, SWS antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.