GPI Picoband polyclonal, anti-mouse
€455.00
In stock
SKU
AC-ABO11687
Catalog Number: AC-ABO11687
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Mouse.Protein Name: Glucose-6-phosphate isomerase
Protein Function:
Besides it's role as a glycolytic enzyme, mammalian GPI can function as a tumor-secreted cytokine and an angiogenic factor (AMF) that stimulates endothelial cell motility. GPI is also a neurotrophic factor (Neuroleukin) for spinal and sensory neurons.
Other Names: Glucose-6-phosphate isomerase, GPI, 5.3.1.9, Autocrine motility factor, AMF, Neuroleukin, NLK, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI, Gpi, Gpi1
Subcellular Localization: Cytoplasm. Secreted.
Gene ID: 14751
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse GPI (2-39aa AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNN), different from the related human sequence by sixteen amino acids, and from the related rat sequence by two amino acids.
Calculated MW: 62767
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Besides it's role as a glycolytic enzyme, mammalian GPI can function as a tumor-secreted cytokine and an angiogenic factor (AMF) that stimulates endothelial cell motility. GPI is also a neurotrophic factor (Neuroleukin) for spinal and sensory neurons.
Other Names: Glucose-6-phosphate isomerase, GPI, 5.3.1.9, Autocrine motility factor, AMF, Neuroleukin, NLK, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI, Gpi, Gpi1
Subcellular Localization: Cytoplasm. Secreted.
Gene ID: 14751
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse GPI (2-39aa AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNN), different from the related human sequence by sixteen amino acids, and from the related rat sequence by two amino acids.
Calculated MW: 62767
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review