Gremlin 1 polyclonal, anti-rat, human

Gremlin 1 polyclonal, anti-rat, human

€384.00
In stock
SKU
ARP-10-P9626
Catalog Number: 10-P9626
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
Gremlin, also known as Drm, is a highly conserved 20.7-kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67). Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.

Description:
Rabbit IgG polyclonal antibody for Gremlin-1 (GREM1) detection. Tested with WB in Human, Rat.

Synonyms:
BMP antagonist 1 antibody, Cell proliferation inducing gene 2 protein antibody, Cell proliferation-inducing gene 2 protein antibody, CKTSF1B1 antibody, Cysteine knot superfamily 1 antibody, Cysteine knot superfamily 1, BMP antagonist 1 antibody, Cysteine knot superfamily BMP antagonist 1 antibody, DAN domain family member 2 antibody, DAND2 antibody, Down regulated in Mos-transformed cells protein antibody, Down-regulated in Mos-transformed cells protein antibody, DRM antibody, grem1 antibody, GREM1_HUMAN antibody, Gremlin 1 like protein antibody, Gremlin 1, cysteine knot superfamily, homolog antibody, GREMLIN antibody, Gremlin-1 antibody, Gremlin1 antibody, IHG-2 antibody, IHG2 antibody, Increased in high glucose 2 antibody, Increased in high glucose protein 2 antibody, PIG2 antibody, Proliferation inducing gene 2 antibody, proliferation inducing gene 2 protein antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD), identical to the related mouse and rat sequences.A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: rat.
Predicted to work with: human.

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Gremlin 1 polyclonal, anti-rat, human