GRK2 Picoband polyclonal, anti-mouse, rat
€455.00
In stock
SKU
AC-ABO12950
Catalog Number: AC-ABO12950
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for GRK2 detection. Tested with WB in Human;Mouse;Rat.
Protein Function:
Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner.
Other Names: Beta-adrenergic receptor kinase 1, Beta-ARK-1, 2.7.11.15, G-protein coupled receptor kinase 2 {ECO:0000312|HGNC:HGNC:289}, GRK2 (HGNC:289), ADRBK1, BARK, BARK1
Subcellular Localization: Cytoplasm.
Tissue Specificity: Expressed in peripheral blood leukocytes.
Gene ID: 156
Immunogen: A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK).
Calculated MW: 79574
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
Protein Function:
Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner.
Other Names: Beta-adrenergic receptor kinase 1, Beta-ARK-1, 2.7.11.15, G-protein coupled receptor kinase 2 {ECO:0000312|HGNC:HGNC:289}, GRK2 (HGNC:289), ADRBK1, BARK, BARK1
Subcellular Localization: Cytoplasm.
Tissue Specificity: Expressed in peripheral blood leukocytes.
Gene ID: 156
Immunogen: A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK).
Calculated MW: 79574
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review